Ssm spooky toxin

http://dbpedia.org/resource/Ssm_spooky_toxin

Spooky toxin (SsTx) is a small peptide neurotoxin. It is found in the venom of Chinese red-headed centipedes (Scolopendra subspinipes mutilans), also known as golden head centipedes. It is originally composed of 76 amino acids (sequence MEKKIIFLVFLVALLALPGFISTEVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG, disulfide bonds Cys43-Cys69, Cys47-Cys71), with a molecular weight of 6017.5 Daltons, but loses the first 23 residues and becomes 53 residues long (sequence EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG, disulfide bonds Cys20-Cys46, Cys24-Cys48). SsTx is currently thought to be unique to Scolopendra subspinipes mutilans. rdf:langString
rdf:langString Ssm spooky toxin
rdf:langString Spooky toxin
xsd:integer 56538986
xsd:integer 1051654526
xsd:integer 3
rdf:langString Scolopendra subspinipes mutilans
rdf:langString SsTx
rdf:langString Spooky toxin (SsTx) is a small peptide neurotoxin. It is found in the venom of Chinese red-headed centipedes (Scolopendra subspinipes mutilans), also known as golden head centipedes. It is originally composed of 76 amino acids (sequence MEKKIIFLVFLVALLALPGFISTEVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG, disulfide bonds Cys43-Cys69, Cys47-Cys71), with a molecular weight of 6017.5 Daltons, but loses the first 23 residues and becomes 53 residues long (sequence EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG, disulfide bonds Cys20-Cys46, Cys24-Cys48). SsTx is currently thought to be unique to Scolopendra subspinipes mutilans. By blocking KCNQ channels (preventing potassium from flowing into and out of cells) SsTx disrupts cardiovascular, respiratory, muscular, and nervous systems; where snake venoms typically only affect circulatory or nervous systems, and venom from spiders, scorpions, and snails typically only target nervous systems. This allows for golden headed centipedes to target larger prey up to 15 times their size.
xsd:integer 5
xsd:nonNegativeInteger 3867

data from the linked data cloud