AmmTX3

http://dbpedia.org/resource/AmmTX3 an entity of type: ChemicalCompound

AmmTX3, produced by Androctonus mauretanicus, is a scorpion toxin of the α-KTX15 subfamily. The toxin is known for its ability to act as a specific Kv4 channel blocker, and thereby reducing the A-type potassium current through this channel. rdf:langString
rdf:langString AmmTX3
rdf:langString Infobox AmmTX3
xsd:integer 48190584
xsd:integer 1105256045
xsd:double 3823.5
rdf:langString Scorpion toxins
rdf:langString Short scorpion toxins
rdf:langString ZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP
rdf:langString α-KTX15
rdf:langString Family
rdf:langString Amino acid
rdf:langString Molecular weight
rdf:langString Subfamily
rdf:langString Superfamily
rdf:langString AmmTX3
rdf:langString background:#ccf;
rdf:langString background:#ddf;
rdf:langString AmmTX3, produced by Androctonus mauretanicus, is a scorpion toxin of the α-KTX15 subfamily. The toxin is known for its ability to act as a specific Kv4 channel blocker, and thereby reducing the A-type potassium current through this channel.
xsd:nonNegativeInteger 7061

data from the linked data cloud